PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00456.1_g00019.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 368aa    MW: 42329.2 Da    PI: 9.799
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00456.1_g00019.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding45.91.3e-14453148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT..TTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg..kgRtlkqcksrwqkyl 48
                             r+rW+ eEd ll  +v+q+G++ W++++ +m+  ++R +k+c +rw +yl
  Rsa1.0_00456.1_g00019.1  4 RQRWSGEEDALLRAYVRQFGPREWHLVSDRMNkpLNRDAKSCLERWKNYL 53
                             89**********************************************97 PP

2Myb_DNA-binding36.31.3e-1159103147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              +g+ T+eE+ l +++ +++G++ Wk+Ia++++ gRt+k +  +w  +
  Rsa1.0_00456.1_g00019.1  59 KGSLTEEEQRLVIRLQEKHGNK-WKKIAAEVP-GRTAKRLGKWWEVF 103
                              6788******************.*********.*****999999766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.287153IPR017930Myb domain
SMARTSM007172.2E-13355IPR001005SANT/Myb domain
SuperFamilySSF466891.39E-21498IPR009057Homeodomain-like
CDDcd001679.13E-8653No hitNo description
Gene3DG3DSA:1.10.10.601.7E-19660IPR009057Homeodomain-like
PfamPF139219.4E-13767No hitNo description
PROSITE profilePS5129423.24854108IPR017930Myb domain
SMARTSM007173.2E-1058106IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-1561102IPR009057Homeodomain-like
CDDcd001675.60E-763104No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 368 aa     Download sequence    Send to blast
MKERQRWSGE EDALLRAYVR QFGPREWHLV SDRMNKPLNR DAKSCLERWK NYLKPGIKKG  60
SLTEEEQRLV IRLQEKHGNK WKKIAAEVPG RTAKRLGKWW EVFKEKQQRE EKESNKRVEP  120
IDESKYDRIL ESFAEKLVKE RSNSIGSVPV AAAAAMANSN GGFLHSDQQA PPSNHVIPPW  180
LATPNNGNNV VVRPPSVTLT LSPSSVAAAA PQPPIPWLQQ QPERGGGGES HVLGSMIPSC  240
GGSSNESVFM SELMECCREL EEGHRAWAEH KKEAAWRLRR LELQLESEKT SRQREKMEEI  300
EAKMKALREE QKMAMEKIEG EYREQLVGLR RDAEAKEQKL ADQWTSKHIR LTKFLEQNMG  360
CRQRLDRP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C4e-15792789C-Myb DNA-Binding Domain
1mse_C4e-15792789C-Myb DNA-Binding Domain
1gv2_A4e-15792789MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009133196.10.0PREDICTED: transcription factor AS1
SwissprotO809310.0AS1_ARATH; Transcription factor AS1
TrEMBLA0A078F7T30.0A0A078F7T3_BRANA; BnaA03g17330D protein
TrEMBLM4C7330.0M4C733_BRARP; Uncharacterized protein
STRINGBra000011.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM61862740
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37630.11e-179MYB family protein